PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6AL_E0ED0DE45.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 206aa    MW: 22578.4 Da    PI: 7.2849
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6AL_E0ED0DE45.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1391.7e-12102156458
                            XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                             +r rr+ +NRe+ArrsR RK++++ eL   v  L + N++L ++l++    + +
  Traes_6AL_E0ED0DE45.1 102 ERRRRRMVSNRESARRSRMRKQKQLSELWAQVVHLRGANRQLLDQLNRVIRDCGR 156
                            5899****************************************99998777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.3E-1399163IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.4E-9100156No hitNo description
PROSITE profilePS5021710.243101153IPR004827Basic-leucine zipper domain
PfamPF001707.6E-10101152IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.9E-11103152No hitNo description
PROSITE patternPS000360106121IPR004827Basic-leucine zipper domain
CDDcd147026.16E-15108154No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MYPAELASVP YLSAATATAA FRPHCQVAPD DFLFQYGGGG LMVPRASSYQ QHDVVGQLLH  60
EAAAGGGLLL PFGARPSNSD ESDECHHHHH QAARCGGSLA EERRRRRMVS NRESARRSRM  120
RKQKQLSELW AQVVHLRGAN RQLLDQLNRV IRDCGRVLRD NSGLRAEQAK LQERLEELPA  180
VPAAVAVAVE GAGEVELDAA QGDMID
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1102123RRRRRMVSNRESARRSRMRKQK
2115122RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570460.13e-69PREDICTED: basic leucine zipper 43-like
TrEMBLW5GAU21e-149W5GAU2_WHEAT; Uncharacterized protein
STRINGBRADI3G56290.18e-69(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118635126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04038.18e-12basic leucine-zipper 48
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]